Structure of PDB 4tnt Chain A

Receptor sequence
>4tntA (length=72) Species: 9606 (Homo sapiens) [Search protein sequence]
SKICLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDK
IRRKNCPACRLQKCLQAGMNLG
3D structure
PDB4tnt Crystal structure of the mineralocorticoid receptor DNA binding domain in complex with DNA.
ChainA
Resolution2.3938 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A C613 H614 Y615 K624 K628 C14 H15 Y16 K25 K29
BS02 dna A S622 R629 R652 K653 R659 S23 R30 R53 K54 R60
BS03 ZN A C603 C606 C620 C623 C4 C7 C21 C24
BS04 ZN A C639 C645 C655 C658 C40 C46 C56 C59
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4tnt, PDBe:4tnt, PDBj:4tnt
PDBsum4tnt
PubMed25188500
UniProtP08235|MCR_HUMAN Mineralocorticoid receptor (Gene Name=NR3C2)

[Back to BioLiP]