Structure of PDB 4s36 Chain A |
>4s36A (length=90) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] |
SSETWRFDDGASLSYDWAAHRYRVELPSGTVEVRVGASEVRVSDGAVSLK APKISLEGPVEIAGTLTVSGDILGGGSIIDTAGNSNHHTH |
|
PDB | 4s36 Crystal structure of the C-terminal domain of R2 pyocin membrane-piercing spike |
Chain | A |
Resolution | 1.46 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FE |
A |
H183 H185 |
H88 H90 |
|
|
|