Structure of PDB 4s18 Chain A |
>4s18A (length=115) Species: 9913 (Bos taurus) [Search protein sequence] |
KETAAAKFERQHMDSYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCS QKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVA CEGNPYVPVHFDASV |
|
PDB | 4s18 Interactions of carboplatin and oxaliplatin with proteins: Insights from X-ray structures and mass spectrometry studies of their ribonuclease A adducts. |
Chain | A |
Resolution | 2.27 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
1PT |
A |
D14 M29 |
D14 M20 |
|
|
|
|