Structure of PDB 4rzr Chain A

Receptor sequence

>4rzrA (length=342) Species: 273057 (Saccharolobus solfataricus P2)

MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEA
RKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIE
IASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVF
AKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGIN
KLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT
MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGR
TFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFIE

3D structure

• PDB: 4rzr Mechanistic Basis for the Bypass of a Bulky DNA Adduct Catalyzed by a Y-Family DNA Polymerase.
• Chain: A
• Resolution: 2.2 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	V32 S34 A42 A44 G58 G218 A220 R240 R242 K243 S244 G246 R247 I248 T250 R331 R336	V32 S34 A42 A44 G58 G218 A220 R240 R242 K243 S244 G246 R247 I248 T250 R331 R336
BS02	dna	A	S103 D105 E106 K152 P184 G185 G187 I189 T190 K193 V296 S297 R298 T301	S103 D105 E106 K152 P184 G185 G187 I189 T190 K193 V296 S297 R298 T301
BS03	CA	A	D7 D105 E106	D7 D105 E106
BS04	CA	A	D7 F8 D105	D7 F8 D105

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4rzr, PDBe:4rzr, PDBj:4rzr
• PDBsum: 4rzr
• PubMed: 26327169
• UniProt: Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)