Structure of PDB 4rvj Chain A |
>4rvjA (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEDMELPGRWKPRMIGGI GGFVKVRQYDQIPIEICGHKVIGTVLVGPTPTNIIGRNLMTQLGCTLNF |
|
PDB | 4rvj Enhanced antiviral activity by the P2-tris-tetrahydrofuran moiety of GRL-0519, a novel nonpeptidic HIV-1 protease inhibitor (PI), against multi-PI-resistant and highly darunavir-resistant strains of HIV-1 |
Chain | A |
Resolution | 1.6 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
D25 T26 G27 |
Catalytic site (residue number reindexed from 1) |
D25 T26 G27 |
Enzyme Commision number |
? |
|
|
|
|