Structure of PDB 4rtl Chain A

Receptor sequence

>4rtlA (length=254) Species: 1110693 (Escherichia coli str. K-12 substr. MDS42)

KNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYIL
ADINSDLISLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQ
DPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFA
EKAQNAFFYCESYADSMARADDSSVVYCDPPYAPLSANSFTLEQQAHLAE
IAEGLVERHIPVLISNHDTMLTREWYQRAKLHVVKVRRSIRKKVDELLAL
YKPG

3D structure

• PDB: 4rtl Structures of Escherichia coli DNA adenine methyltransferase (Dam) in complex with a non-GATC sequence: potential implications for methylation-independent transcriptional repression.
• Chain: A
• Resolution: 2.193 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.72: site-specific DNA-methyltransferase (adenine-specific).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	R95 R124 N126 L127	R93 R122 N124 L125
BS02	SFG	A	F35 V36 A38 D54 I55 D181	F33 V34 A36 D52 I53 D179

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0008168 methyltransferase activity
• GO:0009007 site-specific DNA-methyltransferase (adenine-specific) activity
• GO:0043565 sequence-specific DNA binding
• GO:1904047 S-adenosyl-L-methionine binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006298 mismatch repair
• GO:0009307 DNA restriction-modification system
• GO:0009411 response to UV
• GO:0032259 methylation
• GO:1902328 bacterial-type DNA replication initiation

External links

• PDB: RCSB:4rtl, PDBe:4rtl, PDBj:4rtl
• PDBsum: 4rtl
• PubMed: 25845600
• UniProt: P0AEE8|DMA_ECOLI DNA adenine methylase (Gene Name=dam)