Structure of PDB 4rs2 Chain A

Receptor sequence

>4rs2A (length=180) Species: 511145 (Escherichia coli str. K-12 substr. MG1655)

HHTDPALRALIRVEIPIDAPGIDALLRRSFESDAEAKLVHDLREDGFLTL
GLVATDDEGQVIGYVAFSPVDVQGEDLQWVGMAPLAVDEKYRGQGLARQL
VYEGLDSLNEFGYAAVVTLGDPALYSRFGFELAAHHDLRCRWPGTESAFQ
VHRLADDALNGVTGLVEYHEHFNRFGLCGR

3D structure

• PDB: 4rs2 1.55 Angstrom Crystal Structure of GNAT Family N-acetyltransferase (YhbS) from Escherichia coli in Complex with CoA.
• Chain: A
• Resolution: 1.55 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	COA	A	S21 F22 A78 V79 R84 G85 G87 L88 A89 R90 A115 L116 R119 C170	S29 F30 A86 V87 R92 G93 G95 L96 A97 R98 A123 L124 R127 C178

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 17:38:09 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4rs2', asym_id = 'A', title = '1.55 Angstrom Crystal Structure of GNAT Family N...(YhbS) from Escherichia coli in Complex with CoA.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4rs2', asym_id='A', title='1.55 Angstrom Crystal Structure of GNAT Family N...(YhbS) from Escherichia coli in Complex with CoA.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0016747', uniprot = '', pdbid = '4rs2', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016747', uniprot='', pdbid='4rs2', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>