Structure of PDB 4rkk Chain A

Receptor sequence
>4rkkA (length=317) Species: 9606 (Homo sapiens) [Search protein sequence]
GSHMRFRFGVVVPPAVAGARPELLVVGSRPELGRWEPRGAVRLRPAGTAA
GDGALALQEPGLWLGEVELAARVDTFWYKFLKREPGGELSWEGNGPHHDR
CCTYNENNLVDGVYCLPIGHWIEATGHTNEMKHTTDFYFNIAGHQAMHYS
RILPNIWLGSCPRQVEHVTIKLKHELGITAVMNFQTEWDIVQNSSGCNRY
PEPMTPDTMIKLYREEGLAYIWMPTPDMSTEGRVQMLPQAVCLLHALLEK
GHIVYVHSNAGVGRSTAAVCGWLQYVMGWNLRKVQYFLMAKRPAVYIDEE
ALARAQEDFFQKFGKVR
3D structure
PDB4rkk Structural mechanism of laforin function in glycogen dephosphorylation and lafora disease.
ChainA
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.3.-
3.1.3.16: protein-serine/threonine phosphatase.
3.1.3.48: protein-tyrosine-phosphatase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GLC A D197 D235 N267 D189 D227 N259
BS02 GLC A M236 A268 M228 A260
BS03 GLC A M139 T142 R241 Y304 M131 T134 R233 Y296
BS04 GLC A K87 W99 G103 K79 W91 G95
BS05 GLC A W32 P104 D107 W35 P96 D99
BS06 GLC A W32 W85 W35 W77
Gene Ontology
Molecular Function
GO:0004373 alpha-1,4-glucan glucosyltransferase (UDP-glucose donor) activity
GO:0004721 phosphoprotein phosphatase activity
GO:0004722 protein serine/threonine phosphatase activity
GO:0004725 protein tyrosine phosphatase activity
GO:0005515 protein binding
GO:0016791 phosphatase activity
GO:0017018 myosin phosphatase activity
GO:0019203 carbohydrate phosphatase activity
GO:0030246 carbohydrate binding
GO:0030247 polysaccharide binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:2001069 glycogen binding
GO:2001070 starch binding
Biological Process
GO:0000045 autophagosome assembly
GO:0001558 regulation of cell growth
GO:0005977 glycogen metabolic process
GO:0005978 glycogen biosynthetic process
GO:0006470 protein dephosphorylation
GO:0006816 calcium ion transport
GO:0006914 autophagy
GO:0007005 mitochondrion organization
GO:0007399 nervous system development
GO:0010468 regulation of gene expression
GO:0010629 negative regulation of gene expression
GO:0014009 glial cell proliferation
GO:0015813 L-glutamate transmembrane transport
GO:0016055 Wnt signaling pathway
GO:0016239 positive regulation of macroautophagy
GO:0016311 dephosphorylation
GO:0031396 regulation of protein ubiquitination
GO:0035335 peptidyl-tyrosine dephosphorylation
GO:0042306 regulation of protein import into nucleus
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0044042 glucan metabolic process
GO:0045786 negative regulation of cell cycle
GO:0046835 carbohydrate phosphorylation
GO:0046959 habituation
GO:0061136 regulation of proteasomal protein catabolic process
GO:1903076 regulation of protein localization to plasma membrane
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0030425 dendrite
GO:0043204 perikaryon
GO:0043231 intracellular membrane-bounded organelle
GO:0098554 cytoplasmic side of endoplasmic reticulum membrane
GO:0098556 cytoplasmic side of rough endoplasmic reticulum membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4rkk, PDBe:4rkk, PDBj:4rkk
PDBsum4rkk
PubMed25544560
UniProtO95278|EPM2A_HUMAN Laforin (Gene Name=EPM2A)

[Back to BioLiP]