Structure of PDB 4rg2 Chain A |
>4rg2A (length=119) Species: 9606 (Homo sapiens) [Search protein sequence] |
SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILL CDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRM AVILSLEQGNRLREQYGLG |
|
PDB | 4rg2 Identification of a fragment-like small molecule ligand for the methyl-lysine binding protein, 53BP1. |
Chain | A |
Resolution | 1.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
3OO |
A |
F1519 D1521 M1584 |
F35 D37 M100 |
BindingDB: IC50=2.9e+4nM,Kd=2.2e+4nM |
|
|