Structure of PDB 4rdu Chain A

Receptor sequence
>4rduA (length=61) Species: 9606 (Homo sapiens) [Search protein sequence]
RKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQN
KRSKIKKIMKN
3D structure
PDB4rdu Crystal structure of a distal-less homeobox protein 5 (Dlx5) from Homo sapiens at 1.85 A resolution
ChainA
Resolution1.85 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R138 R141 Y161 R167 K182 Q186 R189 R1 R4 Y24 R30 K45 Q49 R52
BS02 dna A R138 K139 R141 T142 Y144 I183 N187 K191 R1 K2 R4 T5 Y7 I46 N50 K54
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4rdu, PDBe:4rdu, PDBj:4rdu
PDBsum4rdu
PubMed
UniProtP56178|DLX5_HUMAN Homeobox protein DLX-5 (Gene Name=DLX5)

[Back to BioLiP]