Structure of PDB 4rd2 Chain A

Receptor sequence

>4rd2A (length=414) Species: 273057 (Saccharolobus solfataricus P2)

AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGY
AETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGAEVLM
ATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKV
DVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEY
IKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQ
EIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYL
DPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPI
RAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQI
AGRWRMIGWGLVEI

3D structure

• PDB: 4rd2 Identification of a second GTP-bound magnesium ion in archaeal initiation factor 2.
• Chain: A
• Resolution: 1.585 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D19 K22 T23 T46 A97
• Catalytic site (residue number reindexed from 1): D18 K21 T22 T45 A96
• Enzyme Commision number: 3.6.5.3: protein-synthesizing GTPase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GNP	A	V18 D19 G21 K22 T23 T24 M45 T46 G96 N149 K150 D152 S184 L186	V17 D18 G20 K21 T22 T23 M44 T45 G95 N148 K149 D151 S183 L185
BS02	MG	A	T23 T46	T22 T45
BS03	GNP	A	V223 K225 K234 S278 R280 A296 G298	V222 K224 K233 S277 R279 A295 G297

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003743 translation initiation factor activity
• GO:0003746 translation elongation factor activity
• GO:0003924 GTPase activity
• GO:0005515 protein binding
• GO:0005525 GTP binding
• GO:0016787 hydrolase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0001731 formation of translation preinitiation complex
• GO:0006412 translation
• GO:0006413 translational initiation
• GO:0006414 translational elongation

External links

• PDB: RCSB:4rd2, PDBe:4rd2, PDBj:4rd2
• PDBsum: 4rd2
• PubMed: 25690901
• UniProt: Q980A5|IF2G_SACS2 Translation initiation factor 2 subunit gamma (Gene Name=eif2g)