Structure of PDB 4r25 Chain A |
>4r25A (length=114) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] |
SHMFKVEIVTRPANFEKLKQELGKIGVTSLTFSNVHGCGLQKAHTELYRG VKIESNVYERLKIEIVVSKVPVDQVTETAKRVLKTGSPGDGKIFVYEISN TINIRTGEEGPEAL |
|
PDB | 4r25 Structures of regulatory machinery reveal novel molecular mechanisms controlling B. subtilis nitrogen homeostasis. |
Chain | A |
Resolution | 2.5193 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
K12 E71 |
K5 E64 |
|
|
|
|