Structure of PDB 4qzi Chain A

Receptor sequence

>4qziA (length=336) Species: 10090 (Mus musculus)

KKISQYACQRRTTLNNYNQLFTDALDILAENDELRENEGSCLAFMRASSV
LKSLPFPITSMKDTEGIPCLGDKVKSIIEGIIEDGESSEAKAVLNDERYK
SFKLFTSVFGVGLKTAEKWFRMGFRTLSKIQSDKSLRFTQMQKAGFLYYE
DLVSCVNRPEAEAVSMLVKEAVVTFLPDALVTMTGGFRRGKMTGHDVDFL
ITSPEATEDEEQQLLHKVTDFWKQQGLLLYCDILEAQKCFLILKLDHGRV
GKGWKAIRVDLVMCPYDRRAFALLGWTGSRQFERDLRRYATHERKMMLDN
HALYDRTKRVFLEAESEEEIFAHLGLDYIEPWERNA

3D structure

• PDB: 4qzi Structural basis for a novel mechanism of DNA bridging and alignment in eukaryotic DSB DNA repair.
• Chain: A
• Resolution: 2.65 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D343 D345 D434
• Catalytic site (residue number reindexed from 1): D196 D198 D260
• Enzyme Commision number: 2.7.7.31: DNA nucleotidylexotransferase.
  3.1.11.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	G186 S187 A190 C216 G218 D219 K220 V221	G39 S40 A43 C69 G71 D72 K73 V74
BS02	dna	A	L189 R193 R458 H466	L42 R46 R284 H292
BS03	dna	A	F256 G257 G259 K261 T262 M288 H342 D343 D345 F405 R432 D434 G449 W450 R454	F109 G110 G112 K114 T115 M141 H195 D196 D198 F240 R258 D260 G275 W276 R280
BS04	ZN	A	D343 D345 D434	D196 D198 D260
BS05	ZN	A	D473 H475	D299 H301
BS06	MG	A	D343 D345	D196 D198
BS07	DCT	A	G333 R336 G341 H342 D343	G186 R189 G194 H195 D196

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0016779 nucleotidyltransferase activity
• GO:0034061 DNA polymerase activity

Biological Process

• GO:0006281 DNA repair

External links

• PDB: RCSB:4qzi, PDBe:4qzi, PDBj:4qzi
• PDBsum: 4qzi
• PubMed: 25762590
• UniProt: P09838|TDT_MOUSE DNA nucleotidylexotransferase (Gene Name=Dntt)