Structure of PDB 4qzg Chain A

Receptor sequence

>4qzgA (length=340) Species: 10090 (Mus musculus)

KKISQYACQRRTTLNNYNQLFTDALDILAENDELRENEGSCLAFMRASSV
LKSLPFPITSMKDTEGIPCLGDKVKSIIEGIIEDGESSEAKAVLNDERYK
SFKLFTSVFGVGLKTAEKWFRMGFRTLSKIQSDKSLRFTQMQKAGFLYYE
DLVSCVNRPEAEAVSMLVKEAVVTFLPDALVTMTGGFRRGKMTGHDVDFL
ITSPEATEDEEQQLLHKVTDFWKQQGLLLYCDILESDHAQKCFLILKLDH
GRVHGKGWKAIRVDLVMCPYDRRAFALLGWTGSRQFERDLRRYATHERKM
MLDNHALYDRTKRVFLEAESEEEIFAHLGLDYIEPWERNA

3D structure

• PDB: 4qzg Structural basis for a novel mechanism of DNA bridging and alignment in eukaryotic DSB DNA repair.
• Chain: A
• Resolution: 2.75 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D343 D345 D434
• Catalytic site (residue number reindexed from 1): D196 D198 D264
• Enzyme Commision number: 2.7.7.31: DNA nucleotidylexotransferase.
  3.1.11.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	G186 S187 A190 P215 C216 G218 K220 V221	G39 S40 A43 P68 C69 G71 K73 V74
BS02	dna	A	L189 R193 R454 R458 R461 R462 H466	L42 R46 R284 R288 R291 R292 H296
BS03	dna	A	F256 G257 G259 K261 T262 M288 F405 R432 R454	F109 G110 G112 K114 T115 M141 F243 R262 R284
BS04	MG	A	D343 D345	D196 D198
BS05	MG	A	D343 D345 D434	D196 D198 D264
BS06	DCT	A	G333 R336 H342 D343 D345 G449 W450 G452 R454 E457	G186 R189 H195 D196 D198 G279 W280 G282 R284 E287

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0016779 nucleotidyltransferase activity
• GO:0034061 DNA polymerase activity

Biological Process

• GO:0006281 DNA repair

External links

• PDB: RCSB:4qzg, PDBe:4qzg, PDBj:4qzg
• PDBsum: 4qzg
• PubMed: 25762590
• UniProt: P09838|TDT_MOUSE DNA nucleotidylexotransferase (Gene Name=Dntt)