Structure of PDB 4qzd Chain A

Receptor sequence

>4qzdA (length=348) Species: 10090 (Mus musculus)

VKKISQYACQRRTTLNNYNQLFTDALDILAENDELRENEGSCLAFMRASS
VLKSLPFPITSMKDTEGIPCLGDKVKSIIEGIIEDGESSEAKAVLNDERY
KSFKLFTSVFGVGLKTAEKWFRMGFRTLSKIQSDKSLRFTQMQKAGFLYY
EDLVSCVNRPEAEAVSMLVKEAVVTFLPDALVTMTGGFRRGKMTGHDVDF
LITSPEATEDEEQQLLHKVTDFWKQQGLLLYCDILESTFEKFKDHFQKCA
LILKLDHGRVHSGKGWKAIRVDLVMCPYDRRAFALLGWTGSRQFERDLRR
YATHERKMMLDNHALYDRTKRVFLEAESEEEIFAHLGLDYIEPWERNA

3D structure

• PDB: 4qzd Structural basis for a novel mechanism of DNA bridging and alignment in eukaryotic DSB DNA repair.
• Chain: A
• Resolution: 2.7 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D343 D345 D434
• Catalytic site (residue number reindexed from 1): D197 D199 D272
• Enzyme Commision number: 2.7.7.31: DNA nucleotidylexotransferase.
  3.1.11.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	G186 A190 C216 G218 K220 V221	G40 A44 C70 G72 K74 V75
BS02	dna	A	L189 R193 R454 R458 R461 T465 H466	L43 R47 R292 R296 R299 T303 H304
BS03	dna	A	G257 G259 K261 T262 D434	G111 G113 K115 T116 D272
BS04	MG	A	D343 D345	D197 D199
BS05	MG	A	D343 D345 D434	D197 D199 D272
BS06	DCT	A	G332 R336 G341 H342 D343 D345 G449 W450 G452 R454 E457	G186 R190 G195 H196 D197 D199 G287 W288 G290 R292 E295

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0016779 nucleotidyltransferase activity
• GO:0034061 DNA polymerase activity

Biological Process

• GO:0006281 DNA repair

External links

• PDB: RCSB:4qzd, PDBe:4qzd, PDBj:4qzd
• PDBsum: 4qzd
• PubMed: 25762590
• UniProt: P09838|TDT_MOUSE DNA nucleotidylexotransferase (Gene Name=Dntt)