Structure of PDB 4qzc Chain A

Receptor sequence

>4qzcA (length=351) Species: 10090 (Mus musculus)

AVKKISQYACQRRTTLNNYNQLFTDALDILAENDELRENEGSCLAFMRAS
SVLKSLPFPITSMKDTEGIPCLGDKVKSIIEGIIEDGESSEAKAVLNDER
YKSFKLFTSVFGVGLKTAEKWFRMGFRTLSKIQSDKSLRFTQMQKAGFLY
YEDLVSCVNRPEAEAVSMLVKEAVVTFLPDALVTMTGGFRRGKMTGHDVD
FLITSPEATEDEEQQLLHKVTDFWKQQGLLLYCDILESTFEKFDLDHFQK
CALILKLDHGRVHQEGKGWKAIRVDLVMCPYDRRAFALLGWTGSRQFERD
LRRYATHERKMMLDNHALYDRTKRVFLEAESEEEIFAHLGLDYIEPWERN
A

3D structure

• PDB: 4qzc Structural basis for a novel mechanism of DNA bridging and alignment in eukaryotic DSB DNA repair.
• Chain: A
• Resolution: 2.75 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D343 D345 D434
• Catalytic site (residue number reindexed from 1): D198 D200 D275
• Enzyme Commision number: 2.7.7.31: DNA nucleotidylexotransferase.
  3.1.11.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	G186 S187 A190 C216 G218 K220 V221	G41 S42 A45 C71 G73 K75 V76
BS02	dna	A	L189 R193 R454 R458 R461 R462 T465 H466	L44 R48 R295 R299 R302 R303 T306 H307
BS03	dna	A	F256 G257 G259 K261 T262 W450	F111 G112 G114 K116 T117 W291
BS04	MG	A	D343 D345	D198 D200
BS05	MG	A	D343 D345 D434	D198 D200 D275
BS06	DCT	A	R336 G341 H342 D343 D345 G449 W450 G452 R454 E457	R191 G196 H197 D198 D200 G290 W291 G293 R295 E298

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0016779 nucleotidyltransferase activity
• GO:0034061 DNA polymerase activity

Biological Process

• GO:0006281 DNA repair

External links

• PDB: RCSB:4qzc, PDBe:4qzc, PDBj:4qzc
• PDBsum: 4qzc
• PubMed: 25762590
• UniProt: P09838|TDT_MOUSE DNA nucleotidylexotransferase (Gene Name=Dntt)