Structure of PDB 4qza Chain A

Receptor sequence

>4qzaA (length=357) Species: 10090 (Mus musculus)

VKKISQYACQRRTTLNNYNQLFTDALDILAENDELRENEGSCLAFMRASS
VLKSLPFPITSMKDTEGIPCLGDKVKSIIEGIIEDGESSEAKAVLNDERY
KSFKLFTSVFGVGLKTAEKWFRMGFRTLSKIQSDKSLRFTQMQKAGFLYY
EDLVSCVNRPEAEAVSMLVKEAVVTFLPDALVTMTGGFRRGKMTGHDVDF
LITSPEATEDEEQQLLHKVTDFWKQQGLLLYCDILESTFEKFKQPSRKVD
ALDHFQKCFLILKLDHGRVHSGKGWKAIRVDLVMCPYDRRAFALLGWTGS
RQFERDLRRYATHERKMMLDNHALYDRTKRVFLEAESEEEIFAHLGLDYI
EPWERNA

3D structure

• PDB: 4qza Structural basis for a novel mechanism of DNA bridging and alignment in eukaryotic DSB DNA repair.
• Chain: A
• Resolution: 2.15 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D343 D345 D434
• Catalytic site (residue number reindexed from 1): D197 D199 D281
• Enzyme Commision number: 2.7.7.31: DNA nucleotidylexotransferase.
  3.1.11.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	G186 S187 A190 C216 G218 D219 K220 V221	G40 S41 A44 C70 G72 D73 K74 V75
BS02	dna	A	L189 R393 V395 A397 R454 R458 R461 R462 H466	L43 R247 V249 A251 R301 R305 R308 R309 H313
BS03	dna	A	F256 G257 G259 K261 T262 M288 H342 L398 F405 R432 D434 W450	F110 G111 G113 K115 T116 M142 H196 L252 F259 R279 D281 W297
BS04	MG	A	D343 D345	D197 D199
BS05	MG	A	D343 D345 D434	D197 D199 D281
BS06	DCT	A	G332 G333 R336 H342 D343 D345 G449 G452 R454 E457	G186 G187 R190 H196 D197 D199 G296 G299 R301 E304

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0016779 nucleotidyltransferase activity
• GO:0034061 DNA polymerase activity

Biological Process

• GO:0006281 DNA repair

External links

• PDB: RCSB:4qza, PDBe:4qza, PDBj:4qza
• PDBsum: 4qza
• PubMed: 25762590
• UniProt: P09838|TDT_MOUSE DNA nucleotidylexotransferase (Gene Name=Dntt)