Structure of PDB 4qxa Chain A

Receptor sequence
>4qxaA (length=172) Species: 10090 (Mus musculus) [Search protein sequence]
SLFKIILLGDGGVGKSSLMNRYVTNKFDSQLFHTIGVEFLNKDLEVDGHF
VTMQIWDTAGLERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEF
IYYADVKEPESFPFVILGNKTDIKERQVSTEEAQAWCKDNGDYPYFETSA
KDSTNVAAAFEEAVRRILATED
3D structure
PDB4qxa Crystal structure of the Rab9A-RUTBC2 RBD complex reveals the molecular basis for the binding specificity of Rab9A with RUTBC2.
ChainA
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 GTP A G16 G17 G19 K20 S21 S22 F32 S34 H38 T39 G65 N124 K125 D127 I128 S154 K156 G11 G12 G14 K15 S16 S17 F27 S29 H33 T34 G60 N119 K120 D122 I123 S149 K151
BS02 MG A S21 T39 S16 T34
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0019003 GDP binding
GO:0042802 identical protein binding
Biological Process
GO:0015031 protein transport
GO:0032482 Rab protein signal transduction
Cellular Component
GO:0000139 Golgi membrane
GO:0005764 lysosome
GO:0005768 endosome
GO:0005770 late endosome
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005794 Golgi apparatus
GO:0005886 plasma membrane
GO:0030659 cytoplasmic vesicle membrane
GO:0030670 phagocytic vesicle membrane
GO:0042470 melanosome
GO:0045335 phagocytic vesicle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4qxa, PDBe:4qxa, PDBj:4qxa
PDBsum4qxa
PubMed25220469
UniProtQ9R0M6|RAB9A_MOUSE Ras-related protein Rab-9A (Gene Name=Rab9a)

[Back to BioLiP]