Structure of PDB 4qtu Chain A

Receptor sequence
>4qtuA (length=134) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
MKFLTTNFLKCSVKACDTSNDNFPLQYDGSKCQLVQDESIEFNPEFLLNI
VDRVDWPAVLTVAAELGNNALPPTKPSFPSSIQELTDDDMAILNDLHTLL
LQTSIAEGEMKCRNCGHIYYIKNGIPNLLLPPHL
3D structure
PDB4qtu Structural and functional studies of Bud23-Trm112 reveal 18S rRNA N7-G1575 methylation occurs on late 40S precursor ribosomes.
ChainA
Resolution2.124 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 ZN A C11 C16 C112 C115 C11 C16 C112 C115
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0008276 protein methyltransferase activity
GO:0016435 rRNA (guanine) methyltransferase activity
GO:0046982 protein heterodimerization activity
GO:0160102 tRNA (guanine(10)-N2)-methyltransferase activity
Biological Process
GO:0000470 maturation of LSU-rRNA
GO:0002098 tRNA wobble uridine modification
GO:0030488 tRNA methylation
GO:0030490 maturation of SSU-rRNA
GO:0042273 ribosomal large subunit biogenesis
GO:0042274 ribosomal small subunit biogenesis
GO:0060566 positive regulation of termination of DNA-templated transcription
GO:0070476 rRNA (guanine-N7)-methylation
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0035657 eRF1 methyltransferase complex
GO:0043527 tRNA methyltransferase complex
GO:0043528 tRNA (m2G10) methyltransferase complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4qtu, PDBe:4qtu, PDBj:4qtu
PDBsum4qtu
PubMed25489090
UniProtP53738|TR112_YEAST Multifunctional methyltransferase subunit TRM112 (Gene Name=TRM112)

[Back to BioLiP]