Structure of PDB 4qqb Chain A

Receptor sequence

>4qqbA (length=169) Species: 7227 (Drosophila melanogaster)

SNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVD
FTSEMDSQRAIKVLNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTI
TDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISAL
NNVIPEGGSQPLSVRLAEE

3D structure

• PDB: 4qqb Structural basis for the assembly of the Sxl-Unr translation regulatory complex.
• Chain: A
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	N130 Y131 Q134 D138 R139 Y142 R146 A147 R155 M157 R158 Y160 K161 G163 S165 F166 G167 Y168 F170 K194 R195 K197 A201 R202 G204 V238 N241 L243 F256 R258 E290	N8 Y9 Q12 D16 R17 Y20 R24 A25 R33 M35 R36 Y38 K39 G41 S43 F44 G45 Y46 F48 K72 R73 K75 A79 R80 G82 V116 N119 L121 F134 R136 E168	PDBbind-CN: Kd=1.24nM

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding

Cellular Component

• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4qqb, PDBe:4qqb, PDBj:4qqb
• PDBsum: 4qqb
• PubMed: 25209665
• UniProt: P19339|SXL_DROME Protein sex-lethal (Gene Name=Sxl)