Structure of PDB 4qq6 Chain A

Receptor sequence

>4qq6A (length=58) Species: 9606 (Homo sapiens)

QQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLS
DLLSPICE

3D structure

• PDB: 4qq6 A small molecule antagonist of SMN disrupts the interaction between SMN and RNAP II.
• Chain: A
• Resolution: 1.75 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	36X	A	W102 Y109 Y127 Y130 N132	W13 Y20 Y38 Y41 N43

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0006397 mRNA processing

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm

External links

• PDB: RCSB:4qq6, PDBe:4qq6, PDBj:4qq6
• PDBsum: 4qq6
• PubMed: 36114190
• UniProt: Q16637|SMN_HUMAN Survival motor neuron protein (Gene Name=SMN1)