Structure of PDB 4qkz Chain A

Receptor sequence

>4qkzA (length=163) Species: 9606 (Homo sapiens)

MLTPGNPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFT
RISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAE
ETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSL
PQDDIDGIQAIYG

3D structure

• PDB: 4qkz Bone-Seeking Matrix Metalloproteinase Inhibitors for the Treatment of Skeletal Malignancy.
• Chain: A
• Resolution: 1.2 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H197 E198 H201 H207
• Catalytic site (residue number reindexed from 1): H118 E119 H122 H128
• Enzyme Commision number: 3.4.24.34: neutrophil collagenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	D137 G169 G171 D173	D58 G90 G92 D94
BS02	CA	A	D154 G155 N157 I159 D177 E180	D75 G76 N78 I80 D98 E101
BS03	ZN	A	H147 D149 H162 H175	H68 D70 H83 H96
BS04	ZN	A	H197 H201 H207	H118 H122 H128
BS05	QZK	A	I159 L160 A161 H197 E198 H201 H207 L214 Y216 P217 N218 Y219	I80 L81 A82 H118 E119 H122 H128 L135 Y137 P138 N139 Y140

Gene Ontology

Molecular Function

• GO:0004222 metalloendopeptidase activity
• GO:0008237 metallopeptidase activity
• GO:0008270 zinc ion binding

Biological Process

• GO:0006508 proteolysis

Cellular Component

• GO:0031012 extracellular matrix

External links

• PDB: RCSB:4qkz, PDBe:4qkz, PDBj:4qkz
• PDBsum: 4qkz
• PubMed: 32492898
• UniProt: P22894|MMP8_HUMAN Neutrophil collagenase (Gene Name=MMP8)