Structure of PDB 4qju Chain A

Receptor sequence
>4qjuA (length=90) Species: 158878 (Staphylococcus aureus subsp. aureus Mu50) [Search protein sequence]
MNKTDLINAVAEQADLTKKEAGSAVDAVFESIQNSLAKGEKVQLIGFGNF
EVRERAARKGRNPQTGKEIDIPASKVPAFKAGKALKDAVK
3D structure
PDB4qju beta-Arm flexibility of HU from Staphylococcus aureus dictates the DNA-binding and recognition mechanism
ChainA
Resolution2.16 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R58 G60 P63 Q64 I71 R58 G60 P63 Q64 I71 PDBbind-CN: Kd=370nM
BS02 dna A A56 K59 R61 P63 E68 A56 K59 R61 P63 E68 PDBbind-CN: Kd=370nM
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
Biological Process
GO:0030261 chromosome condensation
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4qju, PDBe:4qju, PDBj:4qju
PDBsum4qju
PubMed25478845
UniProtQ99U17|DBH_STAAM DNA-binding protein HU (Gene Name=hup)

[Back to BioLiP]