Structure of PDB 4qh8 Chain A

Receptor sequence
>4qh8A (length=85) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
RKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPT
WHCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKS
3D structure
PDB4qh8 The Mechanism of Dynein Light Chain LC8-mediated Oligomerization of the Ana2 Centriole Duplication Factor.
ChainA
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A R60 N61 F62 G63 S64 Y65 V66 T67 H68 T70 F73 Y75 Y77 R57 N58 F59 G60 S61 Y62 V63 T64 H65 T67 F70 Y72 Y74
BS02 peptide A I34 E35 K36 I31 E32 K33
Gene Ontology
Molecular Function
GO:0003714 transcription corepressor activity
GO:0005515 protein binding
GO:0042803 protein homodimerization activity
GO:0045505 dynein intermediate chain binding
GO:0051959 dynein light intermediate chain binding
GO:0097718 disordered domain specific binding
Biological Process
GO:0000132 establishment of mitotic spindle orientation
GO:0007017 microtubule-based process
GO:0007283 spermatogenesis
GO:0007290 spermatid nucleus elongation
GO:0007291 sperm individualization
GO:0007476 imaginal disc-derived wing morphogenesis
GO:0008407 chaeta morphogenesis
GO:0022416 chaeta development
GO:0034454 microtubule anchoring at centrosome
GO:0035220 wing disc development
GO:0045892 negative regulation of DNA-templated transcription
GO:0048477 oogenesis
GO:0051017 actin filament bundle assembly
GO:0141006 piRNA-mediated retrotransposon silencing by heterochromatin formation
GO:1904801 positive regulation of neuron remodeling
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005814 centriole
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005868 cytoplasmic dynein complex
GO:0005874 microtubule
GO:0005875 microtubule associated complex
GO:0015630 microtubule cytoskeleton
GO:0030286 dynein complex
GO:0032991 protein-containing complex
GO:0090571 RNA polymerase II transcription repressor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4qh8, PDBe:4qh8, PDBj:4qh8
PDBsum4qh8
PubMed24920673
UniProtQ24117|DYL1_DROME Dynein light chain 1, cytoplasmic (Gene Name=ctp)

[Back to BioLiP]