Structure of PDB 4qbr Chain A

Receptor sequence

>4qbrA (length=136) Species: 9606 (Homo sapiens)

SRERLVYEVRQKCRNIEDICISCGSLNVTLEHPLFVGGMCQNCKNCFLEC
AYQYDDDGYQSYCTICCGGREVLMCDNNNCCRCFCVECVDLLVGPGAAQA
AIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFA

3D structure

• PDB: 4qbr Engineering of a histone-recognition domain in a de novo DNA methyltransferase alters the epigenetic landscape of ESCs
• Chain: A
• Resolution: 1.902 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.-
  2.1.1.37: DNA (cytosine-5-)-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	D529 D531 Y533 Q534 Y536 G543 R544 E545 V546 L547 M548 C549 D550 A575 I576 E578 W581	D55 D57 Y59 Q60 Y62 G69 R70 E71 V72 L73 M74 C75 D76 A101 I102 E104 W107
BS02	ZN	A	C549 C554 C583 C586	C75 C80 C109 C112
BS03	ZN	A	C537 C540 C559 C562	C63 C66 C85 C88
BS04	ZN	A	C494 C497 C514 C517	C20 C23 C40 C43

External links

• PDB: RCSB:4qbr, PDBe:4qbr, PDBj:4qbr
• PDBsum: 4qbr
• UniProt: Q9Y6K1|DNM3A_HUMAN DNA (cytosine-5)-methyltransferase 3A (Gene Name=DNMT3A)