Structure of PDB 4q41 Chain A

Receptor sequence

>4q41A (length=333) Species: 6183 (Schistosoma mansoni)

KLLYTSANFLGIPTNRGQPKIGTYQGPELIRKSNFFQLVAEDGIQLTDCG
DIIPVELNEAEDPQRFGMKWSRSFSLTTLRIAERVEELMKQKSTPLVIVG
GDHSMATGTILGHAEAKPDLCVLWIDAHGDINTPLNSASGNMHGMPLSFL
VKELQDQIPWLDDFEGIKPCLNASNIAYIGLRDLDAHETHDIRKHGIAYF
TMLDVDRMGIEAVIKEALLAVNPRLEKAIHLSFDIDALDPLVAPSTGTAV
PGGLTLREGLRICEEVSATGKLSVVELAELNPLLGSQEDVLKTQSSAVHI
LRACLGHCRSGHLPFKVRNLTDQGIMSRAAHMQ

3D structure

• PDB: 4q41 Crystal Structure of Schistosoma mansoni Arginase, a Potential Drug Target for the Treatment of Schistosomiasis.
• Chain: A
• Resolution: 2.199 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H131 D154 H156 D158 H171 D262 D264 E307
• Catalytic site (residue number reindexed from 1): H103 D126 H128 D130 H143 D234 D236 E279
• Enzyme Commision number: 3.5.3.1: arginase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	A	H131 D154 D158 D262	H103 D126 D130 D234
BS02	MN	A	D154 H156 D262 D264	D126 H128 D234 D236
BS03	LYS	A	N160 H171 D213	N132 H143 D185

Gene Ontology

Molecular Function

• GO:0004053 arginase activity
• GO:0016787 hydrolase activity
• GO:0016813 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines
• GO:0030145 manganese ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0000050 urea cycle
• GO:0006525 arginine metabolic process
• GO:0019547 arginine catabolic process to ornithine

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:4q41, PDBe:4q41, PDBj:4q41
• PDBsum: 4q41
• PubMed: 25007099
• UniProt: Q6WVP6