Structure of PDB 4q40 Chain A

Receptor sequence

>4q40A (length=335) Species: 6183 (Schistosoma mansoni)

KLLYTSANFLGIPTNRGQPKIGTYQGPELIRKSNFFQLVAEDGIQLTDCG
DIIPVELNEAEDPQRFGMKWSRSFSLTTLRIAERVEELMKQSNKSTPLVI
VGGDHSMATGTILGHAEAKPDLCVLWIDAHGDINTPLNSASGNMHGMPLS
FLVKELQDQIPWLDDFEGIKPCLNASNIAYIGLRDLDAHETHDIRKHGIA
YFTMLDVDRMGIEAVIKEALLAVNPRLEKAIHLSFDIDALDPLVAPSTGT
AVPGGLTLREGLRICEEVSATGKLSVVELAELNPLLGSQEDVLKTQSSAV
HILRACLGHCRSGHLPFKVRNLTDQGIMSRAAHMQ

3D structure

• PDB: 4q40 Crystal Structure of Schistosoma mansoni Arginase, a Potential Drug Target for the Treatment of Schistosomiasis.
• Chain: A
• Resolution: 1.831 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H131 D154 H156 D158 H171 D262 D264 E307
• Catalytic site (residue number reindexed from 1): H105 D128 H130 D132 H145 D236 D238 E281
• Enzyme Commision number: 3.5.3.1: arginase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	A	H131 D154 D158 D262	H105 D128 D132 D236
BS02	MN	A	D154 H156 D262 D264	D128 H130 D236 D238
BS03	VAL	A	S167 G172 D213	S141 G146 D187

Gene Ontology

Molecular Function

• GO:0004053 arginase activity
• GO:0016787 hydrolase activity
• GO:0016813 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines
• GO:0030145 manganese ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0000050 urea cycle
• GO:0006525 arginine metabolic process
• GO:0019547 arginine catabolic process to ornithine

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:4q40, PDBe:4q40, PDBj:4q40
• PDBsum: 4q40
• PubMed: 25007099
• UniProt: Q6WVP6