Structure of PDB 4pyw Chain A

Receptor sequence

>4pywA (length=362) Species: 9606 (Homo sapiens) [Search protein sequence]

FNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADT
HDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSE
GLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDL
VKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMK
RLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDII
TKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVT
LSKAVHKAVLTIDEKGTEAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKS
PLFMGKVVNPTQ

3D structure

PDB

4pyw An integrative approach combining ion mobility mass spectrometry, X-ray crystallography, and nuclear magnetic resonance spectroscopy to study the conformational dynamics of alpha 1 -antitrypsin upon ligand binding.

Chain

Resolution

1.91 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	T165 F189 F190 K191 G192 W194 Y244 A336 V337 L338 T339 I340 D341 K343 G344 M374 F384	T143 F167 F168 K169 G170 W172 Y222 A308 V309 L310 T311 I312 D313 K315 G316 M343 F353
BS02	peptide	A	S56 F61 L172 L184 V185 N186 Y187 I188 A332 V333 H334 K335	S34 F39 L150 L162 V163 N164 Y165 I166 A304 V305 H306 K307

Gene Ontology

	Molecular Function
GO:0002020	protease binding
GO:0004867	serine-type endopeptidase inhibitor activity
GO:0005515	protein binding
GO:0042802	identical protein binding

	Biological Process
GO:0006953	acute-phase response
GO:0007596	blood coagulation
GO:0010466	negative regulation of peptidase activity

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space
GO:0005783	endoplasmic reticulum
GO:0005788	endoplasmic reticulum lumen
GO:0005794	Golgi apparatus
GO:0030134	COPII-coated ER to Golgi transport vesicle
GO:0031093	platelet alpha granule lumen
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane
GO:0043231	intracellular membrane-bounded organelle
GO:0062023	collagen-containing extracellular matrix
GO:0070062	extracellular exosome
GO:1904813	ficolin-1-rich granule lumen

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4pyw, PDBe:4pyw, PDBj:4pyw
PDBsum	4pyw
PubMed	26011795
UniProt	P01009\|A1AT_HUMAN Alpha-1-antitrypsin (Gene Name=SERPINA1)

[Back to BioLiP]