Structure of PDB 4pya Chain A

Receptor sequence

>4pyaA (length=124) Species: 83333 (Escherichia coli K-12)

ETVREARAEAFVTMRSETLAMIIDGRHHAGDVFATARIAGIQAAKRTWDL
IPLCHPLMLSKVEVNLQAEPEHNRVRIETLCRLTGKTGVEMEALTAASVA
ALTIYDMCKAVQKDMVIGPVRLLA

3D structure

• PDB: 4pya Mechanism of pyranopterin ring formation in molybdenum cofactor biosynthesis.
• Chain: A
• Resolution: 1.789 Å

Enzymatic activity

• Enzyme Commision number: 4.6.1.17: cyclic pyranopterin monophosphate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	2X3	A	L75 C76 H77 L79 G110 M113 E114	L53 C54 H55 L57 G88 M91 E92

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0016829 lyase activity
• GO:0042802 identical protein binding
• GO:0061799 cyclic pyranopterin monophosphate synthase activity

Biological Process

• GO:0006777 Mo-molybdopterin cofactor biosynthetic process

Cellular Component

• GO:0032991 protein-containing complex

External links

• PDB: RCSB:4pya, PDBe:4pya, PDBj:4pya
• PDBsum: 4pya
• PubMed: 25941396
• UniProt: P0A738|MOAC_ECOLI Cyclic pyranopterin monophosphate synthase (Gene Name=moaC)