Structure of PDB 4pv1 Chain A

Receptor sequence

>4pv1A (length=213) Species: 83541 (Mastigocladus laminosus)

NVYDWFQERLEIQALADDVTSKYVPPHVNIFYCLGGITLTCFLIQFATGF
AMTFYYKPTVTEAYASVQYIMNEVSFGWLIRSIHRWSASMMVLMMILHVF
RVYLTGGFKKPRELTWISGVILAVITVSFGVTGYSLPWDQVGYWAVKIVS
GVPEAIPVVGVLISDLLRGGSSVGQATLTRYYSAHTFVLPWLIAVFMLLH
FLMIRKQGISGPL

3D structure

• PDB: 4pv1 Traffic within the cytochrome b6f lipoprotein complex: gating of the quinone portal.
• Chain: A
• Resolution: 3.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R207 I211
• Catalytic site (residue number reindexed from 1): R205 I209

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	V30 N31 I32	V28 N29 I30
BS02	HEC	A	F44 Q47 F48 G51 M54 R83 H86 F131 G135 L138 P139 H187 T188	F42 Q45 F46 G49 M52 R81 H84 F129 G133 L136 P137 H185 T186
BS03	HEC	A	Y34 G37 T40 H100 V101 R103 V104 G109 R114 T117 W118 G121 M199 H202 I206 I211 S212	Y32 G35 T38 H98 V99 R101 V102 G107 R112 T115 W116 G119 M197 H200 I204 I209 S210
BS04	HEC	A	V30 Y34 C35 G38 F203 R207 G210	V28 Y32 C33 G36 F201 R205 G208
BS05	SMA	A	K24 R207	K22 R205

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity
• GO:0046872 metal ion binding

Biological Process

• GO:0015979 photosynthesis
• GO:0022904 respiratory electron transport chain

Cellular Component

• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:4pv1, PDBe:4pv1, PDBj:4pv1
• PDBsum: 4pv1
• PubMed: 25296314
• UniProt: P83791|CYB6_MASLA Cytochrome b6 (Gene Name=petB)