Structure of PDB 4pr6 Chain A

Receptor sequence
>4pr6A (length=95) Species: 9606 (Homo sapiens) [Search protein sequence]
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRG
QAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMA
3D structure
PDB4pr6 New tools provide a second look at HDV ribozyme structure, dynamics and cleavage.
ChainA
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna A Y13 N15 N16 E19 K22 S48 L49 K50 M51 R52 Q54 F56 K80 R83 Q85 A87 K88 D90 S91 D92 Y10 N12 N13 E16 K19 S45 L46 K47 M48 R49 Q51 F53 K77 R80 Q82 A84 K85 D87 S88 D89
BS02 MG A S48 L49 K50 M51 S45 L46 K47 M48
BS03 MG A D24 K27 K28 D21 K24 K25
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:4pr6, PDBe:4pr6, PDBj:4pr6
PDBsum4pr6
PubMed25326328
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]