Structure of PDB 4pqi Chain A

Receptor sequence

>4pqiA (length=238) Species: 3694 (Populus trichocarpa)

TASALDKSVPEKLAPPLDATAEQPPLFDGTTKLYTCYTCPFAQRVWITRN
FKGLQDEIKLVPLILQNRPAWYPEKVYPPNKVPSLEHNGKITGESLDLIK
YLESNFEGPSLLPKDPAKKEFAEELFSYTDKFNGTVYTAFKGDLAKEAGP
AFDHLENALHKFDDGPFFLGKEFSLVDIAYIPFVERLNIFLLEVFKYDIT
AGRQKLAAWIEEVNKIEAYKQTKTDPKELVEFYKKRFL

3D structure

• PDB: 4pqi Structural and enzymatic insights into Lambda glutathione transferases from Populus trichocarpa, monomeric enzymes constituting an early divergent class specific to terrestrial plants.
• Chain: A
• Resolution: 1.95 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GSH	A	C41 F43 R70 K83 V84 E96 S97	C39 F41 R68 K81 V82 E94 S95
BS02	CA	A	F164 G167	F162 G165
BS03	CA	A	H162 D165	H160 D163
BS04	CA	A	G55 E59	G53 E57

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Thu Mar 6 02:18:24 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4pqi', asym_id = 'A', title = 'Structural and enzymatic insights into Lambda gl... divergent class specific to terrestrial plants. '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4pqi', asym_id='A', title='Structural and enzymatic insights into Lambda gl... divergent class specific to terrestrial plants. ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0004364,0005737', uniprot = '', pdbid = '4pqi', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004364,0005737', uniprot='', pdbid='4pqi', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>