Structure of PDB 4pom Chain A

Receptor sequence

>4pomA (length=107) Species: 9606 (Homo sapiens)

GTMVKQIESKTAFQKALKAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEK
YSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKKKLE
ATINKLV

3D structure

• PDB: 4pom BNP7787 Forms Novel Covalent Adducts on Human Thioredoxin and Modulates Thioredoxin Activity
• Chain: A
• Resolution: 1.85 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C32 G33 P34 C35
• Catalytic site (residue number reindexed from 1): C34 G35 P36 C37

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	COM	A	E68 C69	E70 C71

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0004791 thioredoxin-disulfide reductase (NADPH) activity
• GO:0005515 protein binding
• GO:0015035 protein-disulfide reductase activity
• GO:0042803 protein homodimerization activity
• GO:0047134 protein-disulfide reductase (NAD(P)H) activity

Biological Process

• GO:0000122 negative regulation of transcription by RNA polymerase II
• GO:0009314 response to radiation
• GO:0033138 positive regulation of peptidyl-serine phosphorylation
• GO:0043388 positive regulation of DNA binding
• GO:0045454 cell redox homeostasis
• GO:0046826 negative regulation of protein export from nucleus
• GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
• GO:0061692 cellular detoxification of hydrogen peroxide
• GO:0071731 response to nitric oxide
• GO:2000170 positive regulation of peptidyl-cysteine S-nitrosylation

Cellular Component

• GO:0005576 extracellular region
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:4pom, PDBe:4pom, PDBj:4pom
• PDBsum: 4pom
• UniProt: P10599|THIO_HUMAN Thioredoxin (Gene Name=TXN)