Structure of PDB 4pl2 Chain A

Receptor sequence

>4pl2A (length=350) Species: 536056 (Escherichia coli DH1)

KINLLDLNRQQMREFFKDLGEKPFRADQVMKWMYHYCCDNFDEMTDINKV
LRGKLKEVAEIRAPEVVEEQRSSDGTIKWAIAVGDQRVETVYIPEDDRAT
LAVSSQVGCALECKFCSTAQQGFNRNLRVSEIIGQVWRAAKIVGAAKVTG
QRPITNVVMMGMGEPLLNLNNVVPAMEIMLDDFGFGLSKRRVTLSTSGVV
PALDKLGDMIDVALAISLHAPNDEIRDEIVPINKKYNIETFLAAVRRYLE
KSNANQGRVTIEYVMLDHVNDGTEHAHQLAELLKDTPCKINLIPWNPFPG
APYGRSSNSRIDRFSKVLMSYGFTTIVRKTRGDDIDDVIDRTKRTLRKRM

3D structure

• PDB: 4pl2 Characterization of a cross-linked protein-nucleic acid substrate radical in the reaction catalyzed by RlmN.
• Chain: A
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	A	C125 L127 C129 F131 C132 G177 G179	C109 L111 C113 F115 C116 G161 G163

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Dec 1 17:46:32 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4pl2', asym_id = 'A', title = 'Characterization of a cross-linked protein-nucle...strate radical in the reaction catalyzed by RlmN.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4pl2', asym_id='A', title='Characterization of a cross-linked protein-nucle...strate radical in the reaction catalyzed by RlmN.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003824,0006364,0008173,0030488,0051536,0070475', uniprot = '', pdbid = '4pl2', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003824,0006364,0008173,0030488,0051536,0070475', uniprot='', pdbid='4pl2', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>