Structure of PDB 4phv Chain A

Receptor sequence

>4phvA (length=99) Species: 11676 (Human immunodeficiency virus 1)

PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGI
GGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

3D structure

• PDB: 4phv Conserved Folding in Retroviral Proteases: Crystal Structure of a Synthetic HIV-1 Protease
• Chain: A
• Resolution: 2.1 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D25 T26 G27
• Catalytic site (residue number reindexed from 1): D25 T26 G27
• Enzyme Commision number: 2.7.7.-
  2.7.7.49: RNA-directed DNA polymerase.
  2.7.7.7: DNA-directed DNA polymerase.
  3.1.-.-
  3.1.13.2: exoribonuclease H.
  3.1.26.13: retroviral ribonuclease H.
  3.4.23.16: HIV-1 retropepsin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	VAC	A	D25 G27 A28 D29 V32 G48 P81 V82	D25 G27 A28 D29 V32 G48 P81 V82	PDBbind-CN: -logKd/Ki=9.17,IC50=0.67nM
BS02	VAC	A	D25 G27 A28 D29 V32 G48 V82	D25 G27 A28 D29 V32 G48 V82	PDBbind-CN: -logKd/Ki=9.17,IC50=0.67nM

Gene Ontology

Molecular Function

• GO:0004190 aspartic-type endopeptidase activity

Biological Process

• GO:0006508 proteolysis

External links

• PDB: RCSB:4phv, PDBe:4phv, PDBj:4phv
• PDBsum: 4phv
• UniProt: P12497|POL_HV1N5 Gag-Pol polyprotein (Gene Name=gag-pol)