Structure of PDB 4pht Chain A

Receptor sequence

>4phtA (length=438) Species: 216895 (Vibrio vulnificus CMCP6)

RLPFSFANRFKMVLEVPPVLYYVEPLNAQALVEVRRVLKQTFVPQAIAAE
AFEKKLTEAYDFFSLAEEAPIIKLINAMLGEAIKEGASDIHIETFEKILS
IRFRVDGVLRDVLSPSRKLAPLLVSRVKVMAKLDIAEKRVPQDGRISLAV
DVRVSTMPSSHGERVVMRLLDKNATRLDLHSLGMTPVNHDNFRHLISRPH
GIILVTGPTGSGKSTTLYAGLQELNSNERNILTVEDPIEFDIDGIGQTQV
NPKVDMTFARGLRAILRQDPDVVMVGEIRDLETAQIAVQASLTGHLVMST
LHTNTAVGAITRLRDMGIEPFLISSSLLGVLAQRLVRTLCQDCKEPYEAD
KEQRKLFALTLYRAKGCEKCNHKGYRGRTGIHELLMVDDKVQELIHAEAG
EQAMDKYIREHTPSIRSDGLDKVLQGVTSLEEVMRVTK

3D structure

• PDB: 4pht Crystal structure of the full-length ATPase GspE from the Vibrio vulnificus type II secretion system in complex with the cytoplasmic domain of GspL.
• Chain: A
• Resolution: 2.83 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	C393 C396 C426	C340 C343 C367
BS02	ANP	A	L235 T262 S264 G265 K266 S267 T268 L388 R437	L182 T209 S211 G212 K213 S214 T215 L335 R378

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Nov 17 03:54:48 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4pht', asym_id = 'A', title = 'Crystal structure of the full-length ATPase GspE... in complex with the cytoplasmic domain of GspL. '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4pht', asym_id='A', title='Crystal structure of the full-length ATPase GspE... in complex with the cytoplasmic domain of GspL. ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0005524,0015627,0015628,0016887', uniprot = '', pdbid = '4pht', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0005524,0015627,0015628,0016887', uniprot='', pdbid='4pht', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>