Structure of PDB 4pcy Chain A

Receptor sequence

>4pcyA (length=99) Species: 3691 (Populus nigra)

IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGV
DASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN

3D structure

• PDB: 4pcy Crystal structure analyses of reduced (CuI) poplar plastocyanin at six pH values.
• Chain: A
• Resolution: 2.15 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H37 C84 H87 M92
• Catalytic site (residue number reindexed from 1): H37 C84 H87 M92

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CU	A	H37 C84 H87 M92	H37 C84 H87 M92

Gene Ontology

Molecular Function

• GO:0005507 copper ion binding
• GO:0009055 electron transfer activity

External links

• PDB: RCSB:4pcy, PDBe:4pcy, PDBj:4pcy
• PDBsum: 4pcy
• PubMed: 3560221
• UniProt: P00299|PLAS1_POPNI Plastocyanin A, chloroplastic (Gene Name=PETE)