Structure of PDB 4pc7 Chain A

Receptor sequence

>4pc7A (length=367) Species: 83333 (Escherichia coli K-12)

TKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGTINTSHVEYDTPTRHY
AHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVG
VPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALK
ALEGDAEWEAKILELAGFLDSYIPEPERAIDKPFLLPIEDVFSISGRGTV
VTGRVERGIIKVGEEVEIVGIKETQKSTCTGVEMFRKLLDEGRAGENVGV
LLRGIKREEIERGQVLAKPGTIKPHTKFESEVYILSKDEGGRHTPFFKGY
RPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMVVTLIHPIAMDDGLRFAI
REGGRTVGAGVVAKVLG

3D structure

• PDB: 4pc7 Structural outline of the detailed mechanism for elongation factor Ts-mediated guanine nucleotide exchange on elongation factor Tu.
• Chain: A
• Resolution: 3.6003 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D21 K24 T25 T61 H84
• Catalytic site (residue number reindexed from 1): D14 K17 T18 T35 H58

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GNP	A	D21 G23 K24 T25 T26 N135 K136 D138 M139 S173 A174 L175	D14 G16 K17 T18 T19 N109 K110 D112 M113 S147 A148 L149
BS02	PUL	A	I92 T93 Q97 Q124 V125 E215 F218 T228 G229 F261 R262 N273 V274 Y331 R333 T334 R373 A375 R377	I66 T67 Q71 Q98 V99 E189 F192 T202 G203 F235 R236 N247 V248 Y305 R307 T308 R347 A349 R351
BS03	MG	A	T25 D80	T18 D54

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003746 translation elongation factor activity
• GO:0003924 GTPase activity
• GO:0005515 protein binding
• GO:0005525 GTP binding
• GO:0097216 guanosine tetraphosphate binding

Biological Process

• GO:0006412 translation
• GO:0006414 translational elongation
• GO:0046677 response to antibiotic

Cellular Component

• GO:0005737 cytoplasm
• GO:0005886 plasma membrane
• GO:0032045 guanyl-nucleotide exchange factor complex

External links

• PDB: RCSB:4pc7, PDBe:4pc7, PDBj:4pc7
• PDBsum: 4pc7
• PubMed: 26073967
• UniProt: P0CE47|EFTU1_ECOLI Elongation factor Tu 1 (Gene Name=tufA)