Structure of PDB 4p9o Chain A |
>4p9oA (length=92) Species: 156889 (Magnetococcus marinus MC-1) [Search protein sequence] |
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESW SMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM |
|
PDB | 4p9o Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism. |
Chain | A |
Resolution | 2.89 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
2CV |
A |
P193 N194 W196 |
P63 N64 W66 |
|
|
|
|