Structure of PDB 4p9e Chain A |
>4p9eA (length=126) Species: 1137745 (Cyanophage S-TIM5) [Search protein sequence] |
MKPEIKEAYMKTAELFSQVSNCKRMKVGAIVVKNGSILAHGWNGTPSGFH TNCCTNPFVLHAEQNALVKMAKSSESIDGSELFCTHSPCPDCSKMIAQAG VKKVYYRNETDGIDVLQQLGVEVEKM |
|
PDB | 4p9e The First Crystal Structure of a dTTP-bound Deoxycytidylate Deaminase Validates and Details the Allosteric-Inhibitor Binding Site. |
Chain | A |
Resolution | 2.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
H67 C95 C98 |
H61 C89 C92 |
|
|
|
|