Structure of PDB 4p7u Chain A |
>4p7uA (length=102) Species: 9606 (Homo sapiens) [Search protein sequence] |
ALCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLE TVCHDPKLPYHDFILEDAASPTCIMKEKKKPGETFFMCSCSSDECNDNII FS |
|
PDB | 4p7u The non-detergent sulfobetaine-201 acts as a pharmacological chaperone to promote folding and crystallization of the type II TGF-beta receptor extracellular domain. |
Chain | A |
Resolution | 1.502 Å |
3D structure |
|
|
Enzyme Commision number |
2.7.11.30: receptor protein serine/threonine kinase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
1PS |
A |
Q41 W65 F111 F126 |
Q16 W40 F86 F101 |
|
|
|
|