Structure of PDB 4p6c Chain A

Receptor sequence

>4p6cA (length=217) Species: 243277 (Vibrio cholerae O1 biovar El Tor str. N16961)

MNQSSLLAEFGDPITRVENALQALREGRGVLLLDDEDRENEGDIIYAVES
LTTAQMALMIRECSGIVCLCLTEAQADRLALPPMVVNNNSANQTAFTVSI
EAKHGVTTGVSAQDRVTTIKTAANPQAKPEDLARPGHVFPLRARAGGVLA
RRGHTEGTVDLMQMAGLQPAGVLCELTNPDGSMAKTPEIIEFGKLHNMPV
LTIEDMVQYRIQFDLKL

3D structure

• PDB: 4p6c Structural Basis for Competitive Inhibition of 3,4-Dihydroxy-2-butanone-4-phosphate Synthase from Vibrio cholerae.
• Chain: A
• Resolution: 1.86 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E39 D43 C68 N92 F96 E101 H137 H154 E175
• Catalytic site (residue number reindexed from 1): E39 D43 C68 N92 F96 E101 H137 H154 E175
• Enzyme Commision number: 4.1.99.12: 3,4-dihydroxy-2-butanone-4-phosphate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	RES	A	R38 E39 C68 T94 F96 R151 G153 H154 T155 E175	R38 E39 C68 T94 F96 R151 G153 H154 T155 E175	MOAD: Ki=100uM PDBbind-CN: -logKd/Ki=4.00,Ki=100uM

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003824 catalytic activity
• GO:0008686 3,4-dihydroxy-2-butanone-4-phosphate synthase activity
• GO:0016829 lyase activity
• GO:0030145 manganese ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0009231 riboflavin biosynthetic process

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:4p6c, PDBe:4p6c, PDBj:4p6c
• PDBsum: 4p6c
• PubMed: 25792735
• UniProt: Q9KKP2|RIBB_VIBCH 3,4-dihydroxy-2-butanone 4-phosphate synthase (Gene Name=ribB)