Structure of PDB 4p4p Chain A

Receptor sequence

>4p4pA (length=282) Species: 5671 (Leishmania infantum)

KYKVPKLKAIQELTQVHGFGPRAAAALFDREGIFTVDELLQKADSIPSLT
DQQRVGIKYFYDINEKIPMQESVLHENYLREKCMEVLGKDFSILICGSYR
RRHPFSGDVDAILSRTLDAPPLSEPVAATGVLGHFVEFLESLKYLEATMA
QGPLKYMGMGRLPPRINTKVYKARRVDIRLIETKSVPTAMLTFTGSKNFN
VIMRQAAISKGYLLNEYGLFKLGTPEEARALYERIGIRGKNAGEELGVPK
DELEDKRVEVRSEQDVFDVLGMPYAKPENRDP

3D structure

• PDB: 4p4p Structures of the Leishmania infantum polymerase beta.
• Chain: A
• Resolution: 2.2973 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D271
• Catalytic site (residue number reindexed from 1): D177
• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	H103 G104 F105 G106 P107 R108 A109 D194 R269 D271 R273 T286 F287 T288 G289 K291 N294	H17 G18 F19 G20 P21 R22 A23 D108 R175 D177 R179 T192 F193 T194 G195 K197 N200
BS02	dna	A	Y33 K34	Y2 K3
BS03	dna	A	Y33 A236 Q237 G238 P239 L240 K241 R298 Q299 I302 L307 N309 E310 Y311 N335 A336 E338	Y2 A150 Q151 G152 P153 L154 K155 R204 Q205 I208 L213 N215 E216 Y217 N241 A242 E244

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0016772 transferase activity, transferring phosphorus-containing groups
• GO:0034061 DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006259 DNA metabolic process
• GO:0006281 DNA repair
• GO:0006303 double-strand break repair via nonhomologous end joining
• GO:0071897 DNA biosynthetic process

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:4p4p, PDBe:4p4p, PDBj:4p4p
• PDBsum: 4p4p
• PubMed: 24666693
• UniProt: Q9U6N3