Structure of PDB 4p4m Chain A

Receptor sequence

>4p4mA (length=270) Species: 5671 (Leishmania infantum)

KPKLKAIQELTQVHGFGPRAAAALFDREGIFTVDELLQKADSIPSLTDQQ
RVGIKYFYDINEKIPMQESVLHENYLREKCMEVLGKDFSILICGSYRRRH
PFSGDVDAILSRTLDAPPLSEPVAATGVLGHFVEFLESLKYLEATMAQGP
LKYMGMGRLPPRINTKVYKARRVDIRLIETKSVPTAMLTFTGSKNFNVIM
RQAAISKGYLLNEYGLFKLGTPEEARGKNAGEELGVPKDELEDKRVEVRS
EQDVFDVLGMPYAKPENRDP

3D structure

• PDB: 4p4m Structures of the Leishmania infantum polymerase beta.
• Chain: A
• Resolution: 1.9185 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D271
• Catalytic site (residue number reindexed from 1): D174
• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	H103 G104 G106 P107 R108 A109 R269 D271	H14 G15 G17 P18 R19 A20 R172 D174
BS02	dna	A	A236 Q237 G238 P239 L240 K241 R273 V295 R298 Q299 I302 L307 E310 Y311 N335 A336 E338	A147 Q148 G149 P150 L151 K152 R176 V198 R201 Q202 I205 L210 E213 Y214 N229 A230 E232
BS03	D3T	A	G183 S184 R187 S192 G193 D194 D196 T286 K291 N294	G94 S95 R98 S103 G104 D105 D107 T189 K194 N197
BS04	MG	A	D194 D196	D105 D107

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0016772 transferase activity, transferring phosphorus-containing groups
• GO:0034061 DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006259 DNA metabolic process
• GO:0006281 DNA repair
• GO:0006303 double-strand break repair via nonhomologous end joining
• GO:0071897 DNA biosynthetic process

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:4p4m, PDBe:4p4m, PDBj:4p4m
• PDBsum: 4p4m
• PubMed: 24666693
• UniProt: Q9U6N3