Structure of PDB 4owf Chain A |
>4owfA (length=83) Species: 10090 (Mus musculus) [Search protein sequence] |
QLEDLRQQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPVLKAQADIY KADFQAERHAREKLVEKKEYLQEQLEQLQREFN |
|
PDB | 4owf Mechanism Underlying I kappa B Kinase Activation Mediated by the Linear Ubiquitin Chain Assembly Complex. |
Chain | A |
Resolution | 2.0 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
A |
Q259 A266 K270 |
Q8 A15 K19 |
|
|
|