Structure of PDB 4ou7 Chain A |
>4ou7A (length=71) Species: 83333 (Escherichia coli K-12) [Search protein sequence] |
VPMGKFAMYPDWQPDADFIRLAALWGVALREPVTTEELASFIAYWQAEGK VFHHVQWQQKLARSLQIGRAS |
|
PDB | 4ou7 Crystal structure of DnaT84-153-dT10 ssDNA complex reveals a novel single-stranded DNA binding mode. |
Chain | A |
Resolution | 2.83 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
A |
Y127 K143 |
Y44 K60 |
|
|
|