Structure of PDB 4or7 Chain A

Receptor sequence

>4or7A (length=165) Species: 1244085 (Klebsiella pneumoniae CG43)

MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVVMGRLTWESI
GRPLPGRKNIVISSKPGSDDRVQWVSSVEEAIAACGDVEEIMVIGGGRVY
EQFLPKAQKLYLTHIDAEVEGDTHFPDYDPDEWESVFSEFHDADAQNSHS
YCFEILERRHHHHHH

3D structure

• PDB: 4or7 Crystal Structures of Klebsiella pneumoniae Dihydrofolate Reductase Bound to Propargyl-Linked Antifolates Reveal Features for Potency and Selectivity.
• Chain: A
• Resolution: 1.76 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	A	A6 A7 I14 N18 A19 M20 W22 G43 R44 L45 T46 I62 S63 S64 S76 I94 G96 G97 R98 V99 Y100 Q102	A6 A7 I14 N18 A19 M20 W22 G43 R44 L45 T46 I62 S63 S64 S76 I94 G96 G97 R98 V99 Y100 Q102
BS02	25U	A	I5 A6 M20 D27 F31 I50 L54 I94	I5 A6 M20 D27 F31 I50 L54 I94	MOAD: ic50=23nM

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 29 03:40:13 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4or7', asym_id = 'A', title = 'Crystal Structures of Klebsiella pneumoniae Dihy...tes Reveal Features for Potency and Selectivity. '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4or7', asym_id='A', title='Crystal Structures of Klebsiella pneumoniae Dihy...tes Reveal Features for Potency and Selectivity. ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0004146,0046654,0050661', uniprot = '', pdbid = '4or7', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004146,0046654,0050661', uniprot='', pdbid='4or7', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>