Structure of PDB 4olt Chain A

Receptor sequence

>4oltA (length=236) Species: 878476 (Pseudomonas sp. LL2(2010))

TVDLDAPVQKDTAMSLVSSFENSSTDWQAQYGYLEDIADGRGYTGGLIGF
TSGTGDMLELVRAYSASSPGNPLEQYIPALEAVNGTDSHAGLGQGFEQAW
ADAAETSEFRAAQDAERDRVYFDPAVAQGKADGLSALGQFAYYDTLVVHG
PGSQRDAFGGIRAEALSAALPPSQGGDETEYLEAFFDARNVIMREEPAHA
DTSRIDTAQRVFLQNGNFDLERPLTWSVYGDQYSLN

3D structure

• PDB: 4olt Structural insights into the substrate-binding mechanism for a novel chitosanase.
• Chain: A
• Resolution: 1.59 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E25 D43 T48
• Catalytic site (residue number reindexed from 1): E21 D39 T44
• Enzyme Commision number: 3.2.1.132: chitosanase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GCS	A	Y233 D235	Y229 D231
BS02	GCS	A	E25 N26 S27 Y233	E21 N22 S23 Y229
BS03	GCS	A	E25 Y37 I41	E21 Y33 I37
BS04	GCS	A	R45 I52 G53 V151 H203	R41 I48 G49 V147 H199
BS05	GCS	A	R45 T58 D60 Y125 V152 H153	R41 T54 D56 Y121 V148 H149
BS06	GCS	A	T58 P155	T54 P151

Gene Ontology

Molecular Function

• GO:0016798 hydrolase activity, acting on glycosyl bonds
• GO:0016977 chitosanase activity

Biological Process

• GO:0005975 carbohydrate metabolic process

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:4olt, PDBe:4olt, PDBj:4olt
• PDBsum: 4olt
• PubMed: 24766439
• UniProt: E1AXU1