Structure of PDB 4ojv Chain A

Receptor sequence

>4ojvA (length=363) Species: 559292 (Saccharomyces cerevisiae S288C)

MVVFEITILGANGGPTEYGTQCFILKPARTEDPELIAVDGGAGMYQLREM
LVQGDDELVPSFYEHDREPIEFFIDSKLNIQKGLSKSLLQSLKRQGEHFE
SANTMKKTYEVFQGITDYYITHPHLDHISGLVVNSPSIYEQENSKKKTIW
GLPHTIDVLQKHVFNDLIWPDLTAERSRKLKLKCLNPKEVQKCTIFPWDV
IPFKVHHGIGVKTGAPVYSTFYIFRDRKSKDCIIVCGDVEQDRRESEESL
LEEFWSYVAENIPLVHLKGILVECSCPLSSKPEQLYGHLSPIYLINELSN
LNTLYNSSKGLSGLNVIVTHVKSTPAKRDPRLTILEELRFLAEERNLGDL
RISIALEGHTLFL

3D structure

• PDB: 4ojv Dual specificity and novel structural folding of yeast phosphodiesterase-1 for hydrolysis of second messengers cyclic adenosine and guanosine 3',5'-monophosphate.
• Chain: A
• Resolution: 1.31 Å

Enzymatic activity

• Enzyme Commision number: 3.1.4.17: 3',5'-cyclic-nucleotide phosphodiesterase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	H128 H130 H213 D244	H122 H124 H207 D238
BS02	ZN	A	D132 H133 D244 H326	D126 H127 D238 H320

Gene Ontology

Molecular Function

• GO:0004114 3',5'-cyclic-nucleotide phosphodiesterase activity
• GO:0004115 3',5'-cyclic-AMP phosphodiesterase activity
• GO:0004118 3',5'-cGMP-stimulated cyclic-nucleotide phosphodiesterase activity
• GO:0004119 3',5'-cGMP-inhibited cyclic-nucleotide phosphodiesterase activity
• GO:0008081 phosphoric diester hydrolase activity
• GO:0008270 zinc ion binding
• GO:0016787 hydrolase activity
• GO:0047555 3',5'-cyclic-GMP phosphodiesterase activity

Biological Process

• GO:0006198 cAMP catabolic process
• GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
• GO:1902660 negative regulation of glucose mediated signaling pathway

Cellular Component

• GO:0005575 cellular_component

External links

• PDB: RCSB:4ojv, PDBe:4ojv, PDBj:4ojv
• PDBsum: 4ojv
• PubMed: 25050706
• UniProt: P22434|PDE1_YEAST 3',5'-cyclic-nucleotide phosphodiesterase 1 (Gene Name=PDE1)