Structure of PDB 4ojt Chain A

Receptor sequence

>4ojtA (length=231) Species: 85963 (Helicobacter pylori J99)

MGQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAY
SKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQ
HDVDLSAFDHPLGFIPESAIFIETSGSLNALAKKIANEQHIALKEGVIAS
GDQFVHSKERKEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDN
ADEKAGMSFDEFLEKSAHTSAKFLKSMVDEL

3D structure

• PDB: 4ojt Crystal structures of the Helicobacter pylori MTAN enzyme reveal specific interactions between S-adenosylhomocysteine and the 5'-alkylthio binding subsite.
• Chain: A
• Resolution: 1.5 Å

Enzymatic activity

• Enzyme Commision number: 3.2.2.30: aminodeoxyfutalosine nucleosidase.
  3.2.2.9: adenosylhomocysteine nucleosidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	2WP	A	E13 I52 F153 M174 E175 R194 F208	E14 I53 F154 M175 E176 R195 F209
BS02	ADE	A	A79 G80 F153 V154 E173 M174 D198 A200	A80 G81 F154 V155 E174 M175 D199 A201

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0008782 adenosylhomocysteine nucleosidase activity
• GO:0008930 methylthioadenosine nucleosidase activity
• GO:0016787 hydrolase activity
• GO:0102246 6-amino-6-deoxyfutalosine hydrolase activity

Biological Process

• GO:0009086 methionine biosynthetic process
• GO:0009116 nucleoside metabolic process
• GO:0009164 nucleoside catabolic process
• GO:0009234 menaquinone biosynthetic process
• GO:0019284 L-methionine salvage from S-adenosylmethionine
• GO:0019509 L-methionine salvage from methylthioadenosine

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:4ojt, PDBe:4ojt, PDBj:4ojt
• PDBsum: 4ojt
• PubMed: 23148563
• UniProt: Q9ZMY2|MQMTN_HELPJ Aminodeoxyfutalosine nucleosidase (Gene Name=mtnN)